SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 295319.SPA1203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295319.SPA1203
Domain Number 1 Region: 120-311
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.28e-51
Family D-glucarate dehydratase-like 0.0000000454
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1e-31
Family Enolase N-terminal domain-like 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 295319.SPA1203
Sequence length 321
Comment (Salmonella enterica Paratypi ATCC 9150)
Sequence
MRSVKVYEETWPLHTPFVIARGSRSEAHVVVVELEEEGVKGIGECTPYPRYGESDASVMA
QTMSIVPQLENGLTREALQKLLPAGAARNAVDSALWDLQARQRQQSLAGLLGVTLAPVFT
TAQTVVIGTPEQMAASAAALWEKGATLLKIKLDARLISERMVAIRSAVPEATLIVDANES
WRPEGLAARCQLLADLNVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSSLKALTGR
YDMINIKLDKTGGLTEALALATEAREQGFGLMLGCMLCTLRAISAALPLMPQVSFADLDG
PTWLTVDVEPALRFTTGQLHL
Download sequence
Identical sequences A0A0H2WNW7 A0A2J1A8I7
gi|56413397|ref|YP_150472.1| CP000026|CDS_1271304-1272269 FM200053|CDS_1265147-1266112 gi|197362320|ref|YP_002141957.1| 295319.SPA1203 554290.SSPA1118 WP_001258078.1.101111 WP_001258078.1.101239 WP_001258078.1.101904 WP_001258078.1.11810 WP_001258078.1.12210 WP_001258078.1.12308 WP_001258078.1.12865 WP_001258078.1.13262 WP_001258078.1.13602 WP_001258078.1.13967 WP_001258078.1.15011 WP_001258078.1.15938 WP_001258078.1.16710 WP_001258078.1.18355 WP_001258078.1.19882 WP_001258078.1.20564 WP_001258078.1.2139 WP_001258078.1.21534 WP_001258078.1.22451 WP_001258078.1.22566 WP_001258078.1.24394 WP_001258078.1.25846 WP_001258078.1.26122 WP_001258078.1.26750 WP_001258078.1.30555 WP_001258078.1.31069 WP_001258078.1.31546 WP_001258078.1.329 WP_001258078.1.33420 WP_001258078.1.33504 WP_001258078.1.34424 WP_001258078.1.35331 WP_001258078.1.35507 WP_001258078.1.36057 WP_001258078.1.36586 WP_001258078.1.36875 WP_001258078.1.38452 WP_001258078.1.38620 WP_001258078.1.39112 WP_001258078.1.39953 WP_001258078.1.40031 WP_001258078.1.40688 WP_001258078.1.42098 WP_001258078.1.4229 WP_001258078.1.42372 WP_001258078.1.44144 WP_001258078.1.44606 WP_001258078.1.44687 WP_001258078.1.4505 WP_001258078.1.47023 WP_001258078.1.47061 WP_001258078.1.47110 WP_001258078.1.47243 WP_001258078.1.47542 WP_001258078.1.47660 WP_001258078.1.48134 WP_001258078.1.48510 WP_001258078.1.48768 WP_001258078.1.48841 WP_001258078.1.49430 WP_001258078.1.49494 WP_001258078.1.49790 WP_001258078.1.50153 WP_001258078.1.50529 WP_001258078.1.50750 WP_001258078.1.5185 WP_001258078.1.52101 WP_001258078.1.54340 WP_001258078.1.5462 WP_001258078.1.55200 WP_001258078.1.56070 WP_001258078.1.56374 WP_001258078.1.56791 WP_001258078.1.56942 WP_001258078.1.57244 WP_001258078.1.5761 WP_001258078.1.58467 WP_001258078.1.59068 WP_001258078.1.59276 WP_001258078.1.60809 WP_001258078.1.61309 WP_001258078.1.6143 WP_001258078.1.61694 WP_001258078.1.62063 WP_001258078.1.62195 WP_001258078.1.64758 WP_001258078.1.65475 WP_001258078.1.65818 WP_001258078.1.65945 WP_001258078.1.67228 WP_001258078.1.67825 WP_001258078.1.69433 WP_001258078.1.69839 WP_001258078.1.7060 WP_001258078.1.70662 WP_001258078.1.71848 WP_001258078.1.72121 WP_001258078.1.72254 WP_001258078.1.72797 WP_001258078.1.72946 WP_001258078.1.73102 WP_001258078.1.73958 WP_001258078.1.74741 WP_001258078.1.75371 WP_001258078.1.76115 WP_001258078.1.7784 WP_001258078.1.78352 WP_001258078.1.78959 WP_001258078.1.79531 WP_001258078.1.79977 WP_001258078.1.80045 WP_001258078.1.81041 WP_001258078.1.81084 WP_001258078.1.81568 WP_001258078.1.81798 WP_001258078.1.82692 WP_001258078.1.83280 WP_001258078.1.83806 WP_001258078.1.84814 WP_001258078.1.84872 WP_001258078.1.84879 WP_001258078.1.86466 WP_001258078.1.87220 WP_001258078.1.87276 WP_001258078.1.87376 WP_001258078.1.87891 WP_001258078.1.88817 WP_001258078.1.89764 WP_001258078.1.91282 WP_001258078.1.91312 WP_001258078.1.91331 WP_001258078.1.9166 WP_001258078.1.91984 WP_001258078.1.92646 WP_001258078.1.92786 WP_001258078.1.92842 WP_001258078.1.92936 WP_001258078.1.93118 WP_001258078.1.94071 WP_001258078.1.95133 WP_001258078.1.96731 WP_001258078.1.99073 WP_001258078.1.99531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]