SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295358.mhp205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295358.mhp205
Domain Number 1 Region: 126-205
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.85e-24
Family Translational machinery components 0.00044
Further Details:      
 
Domain Number 2 Region: 55-123
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.07e-22
Family Ribosomal S5 protein, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 295358.mhp205
Sequence length 216
Comment (Mycoplasma hyopneumoniae 232)
Sequence
MDRKLENQKDLLNQDPKVELNSQSVAKNPLNSREVKPIQRRRPLRKNSRDKNSKPEFEER
VIAIHRVVKVVKGGRRFSFSAFAVVGNKKGRVGFGHGKANEVQDAVKKAIKDAQNRLVSV
PIYRKSTVPHEIAVKYLASKILIKPAPRGKGIVASNTVRAVVELAGYTDIYTKTYGSRTK
INVVRATLKALLKLRTINQVAELRDLSPQQAQAQKV
Download sequence
Identical sequences Q4AAF7 Q601J7
WP_011206042.1.100269 WP_011206042.1.51147 WP_011206042.1.76180 gi|54020087|ref|YP_115718.1| 262719.MHJ_0173 295358.mhp205 gi|71893529|ref|YP_278975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]