SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 295405.BF2967 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF2967
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.44e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 295405.BF2967
Sequence length 101
Comment (Bacteroides fragilis YCH46)
Sequence
MEKYEIHSVGSVLDSNTSGDEQAKIVALIEQGHSVALDLSGCSYVSSAGLRVMLYAFKLA
KAKSRDVCLVGVSQEVKDVMHMTGFDKFFRFYQTLDELSQP
Download sequence
Identical sequences Q64S16
gi|53714257|ref|YP_100249.1| WP_011203081.1.76253 YP_100249.1.45732 295405.BF2967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]