SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 295405.BF3095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  295405.BF3095
Domain Number - Region: 17-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000212
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 295405.BF3095
Sequence length 89
Comment (Bacteroides fragilis YCH46)
Sequence
MEQKFCQSCGMPLNPEVLGTEKDGSKNEEYCTYCYADGHFTVECTMDEMINQCAQFVDEF
NKGSEVKMTKEEAIANMKQFFPMLKRWKQ
Download sequence
Identical sequences A0A015SGT5 A0A015TH92 A0A015TSW9 A0A015TZS7 A0A015VC22 A0A015WFZ9 A0A015YBE3 A0A015YYS6 A0A016CIZ8 A0A016CN64 A0A016E646 A0A016FYA3 A0A017N6N0 A0A017NFK4 A0A0E2A9M4 A0A0E2AKG8 A0A0E2RLA5 A0A0E2SU82 A0A0K6BWX0 A0A139TDQ3 D1JTA7 E1WS91 F7LWC0 I9KBT3 Q5LB94 Q64RP1 R6ZKM4
gi|375359185|ref|YP_005111957.1| 272559.BF2933 295405.BF3095 gi|60682403|ref|YP_212547.1| gi|53714382|ref|YP_100374.1| WP_005788894.1.10040 WP_005788894.1.100686 WP_005788894.1.10083 WP_005788894.1.10405 WP_005788894.1.11335 WP_005788894.1.15557 WP_005788894.1.18542 WP_005788894.1.2011 WP_005788894.1.21107 WP_005788894.1.21713 WP_005788894.1.21908 WP_005788894.1.22050 WP_005788894.1.23698 WP_005788894.1.26260 WP_005788894.1.26832 WP_005788894.1.26934 WP_005788894.1.30158 WP_005788894.1.30608 WP_005788894.1.31541 WP_005788894.1.32651 WP_005788894.1.33107 WP_005788894.1.34692 WP_005788894.1.35533 WP_005788894.1.35582 WP_005788894.1.35818 WP_005788894.1.36984 WP_005788894.1.37052 WP_005788894.1.37988 WP_005788894.1.38746 WP_005788894.1.39779 WP_005788894.1.40326 WP_005788894.1.40404 WP_005788894.1.4066 WP_005788894.1.42362 WP_005788894.1.43770 WP_005788894.1.43857 WP_005788894.1.44936 WP_005788894.1.456 WP_005788894.1.46679 WP_005788894.1.48703 WP_005788894.1.49420 WP_005788894.1.49748 WP_005788894.1.50677 WP_005788894.1.50935 WP_005788894.1.51373 WP_005788894.1.5142 WP_005788894.1.51489 WP_005788894.1.51763 WP_005788894.1.52936 WP_005788894.1.53885 WP_005788894.1.53910 WP_005788894.1.53995 WP_005788894.1.54019 WP_005788894.1.55270 WP_005788894.1.56204 WP_005788894.1.57121 WP_005788894.1.58084 WP_005788894.1.60699 WP_005788894.1.60854 WP_005788894.1.6251 WP_005788894.1.63108 WP_005788894.1.63590 WP_005788894.1.65409 WP_005788894.1.65726 WP_005788894.1.65921 WP_005788894.1.66858 WP_005788894.1.66941 WP_005788894.1.69826 WP_005788894.1.73957 WP_005788894.1.75176 WP_005788894.1.75668 WP_005788894.1.7580 WP_005788894.1.76253 WP_005788894.1.77492 WP_005788894.1.78347 WP_005788894.1.81678 WP_005788894.1.85293 WP_005788894.1.87523 WP_005788894.1.88754 WP_005788894.1.89424 WP_005788894.1.89499 WP_005788894.1.89819 WP_005788894.1.91045 WP_005788894.1.91849 WP_005788894.1.93484 WP_005788894.1.93759 WP_005788894.1.9461 WP_005788894.1.94953 WP_005788894.1.95091 WP_005788894.1.95195 WP_005788894.1.95750 WP_005788894.1.97349 WP_005788894.1.97365 WP_005788894.1.97964 WP_005788894.1.98903 WP_005788894.1.9932 YP_100374.1.45732 APC20260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]