SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 296591.Bpro_0718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  296591.Bpro_0718
Domain Number 1 Region: 583-707
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-26
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 456-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000102
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 296591.Bpro_0718
Sequence length 747
Comment (Polaromonas JS666)
Sequence
MRELIKISRADMRGGVQASLRGLTTTVAPVLLFMTMLGPESMAAGFWATMITATLIPAVN
LLLRGQPAVIPGARMASLAAYVWLVISLTAAAGDAAGHAPRLHLTVAQLAVGLAAGSLMF
MVASALVLLCGLLKIGNLFKMIPMPVTAGISNGTALLLLMLGIQTLTDNGRLAAFTAVGM
VACFVVWPRLLVRAKALNFIPGVVAALLAGVLISMLLMESPFRSSGAWLAPDWAWMSVRL
WSELPQHDFARLLKIGLPGVMTLALVMILETFTAANEMEQRFGIRINPNRELVVLGGCNI
VSALLGGVPCTGHNSRSISSWLAGGRGVYVALVGLVFTGVLLLAFGTWLVILPVGMVAGI
LLLQALLMAEREFFHRLWEIVRTRHWRREGTSDLGFWTTVVISIVEYFGNMIWACFMGIG
LSCLVILRRVSDSLTTKWNYLDRYRSRRVRTFEESNLLTHSFNRVGILKLNGHLFFGNSI
RLTQLVDELNPNAKAVVIDVSHVLDVDPSGLNALTWLIRAVVERDLTVVLTGMNRTRSSE
LHEALQAIPGVQRCIDMDRGLELCEDVVLSEASTKSAESLVVSLQENSLLDGLTAEEVTE
VLLLGEARQVDKGEVLFFKGSEADGVWLLEEGNVSILSGGDQSTRLSTLGPGQFLGEMSL
IDGKPRSATAQADSPLRALLLDKQAIAALMSREPEATLKIMRNIVKYLSYRIRSTSALLA
EETSEPVSTSEPASGWSNSIQSNLSRL
Download sequence
Identical sequences Q12FL8
296591.Bpro_0718 gi|91786620|ref|YP_547572.1| WP_011481677.1.11221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]