SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 296591.Bpro_5118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  296591.Bpro_5118
Domain Number 1 Region: 116-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.96e-73
Family D-glucarate dehydratase-like 0.00017
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.26e-31
Family Enolase N-terminal domain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 296591.Bpro_5118
Sequence length 382
Comment (Polaromonas JS666)
Sequence
MKITKINAIPLSYRLPEGKTVTMGVGSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAIT
SLIHNTIAPMLIGMKATDCVGAWQRVHRMQLSSHGLGAGAALAISGIDMALWDIRGKAAN
MPLYELLGGSKRRIPAYAGGIALGYQPKESLAEEAQEYIARGYKALKLRIGDAARVDIER
VRHVRKVLGDEVDILTDANTAYTMADARRVLPVLAEIQAGWLEEPFACNDFASYREVAKI
TPLVPIAAGENHYTRFEFGQMLDAGAVQVWQPDLSKCGGITEGIRIAAMASAYRIPINAH
SSATGLNHAATIHFLAATENAGYFEACVSKFNPFRDMFGTSFEIGADGCVEPPDAPGLGI
EVDESIFEKYPAVDGPGYVVKF
Download sequence
Identical sequences Q120Q7
gi|91790932|ref|YP_551883.1| 296591.Bpro_5118 gi|91790932|ref|YP_551883.1|NC_007949 WP_011485968.1.11221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]