SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 297245.lpl2887 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  297245.lpl2887
Domain Number 1 Region: 72-260
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.62e-29
Family Clp protease, ClpP subunit 0.014
Further Details:      
 
Domain Number 2 Region: 432-495
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000068
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 297245.lpl2887
Sequence length 501
Comment (Legionella pneumophila Lens)
Sequence
MHRDCVRQEELHKLNNLFCKWAAVTRTLQGIIFRSRLSVSVLEDSDSVAVKQSPPSVTCK
IRLSKFMQTSCIFIFLTLFLLVGLQTSFAAKIVELNIKGPIGPATADYLERGIKSAQDAD
LIVILIDTPGGLYDSTRNIIQLFLLSDVPIVTYVSPTGARAASAGTYLMYASTLAAMAPG
TQMGAASPVSLGTGFSEGEKDEKKKSTMENKVTHDAVATIRSLAQLRGRDLDFAEKAVTE
GKSITANEALSKGVVNYIAKNRDDLLSQINGIKVSQNNKTITINTENPDIQVINPDWRTR
FLSVITNPTVAYLLLLLGIYGIFFELVNPGYVLPGVVGAVSMLFALYALQLLPINYAGLG
LIILGILFVIAEAFTPSFGALGVGGTVSFILGSIMLMNTEHLAFQIAWSAIWAMAVLNIL
IFVLVLGMLIKSRNQKIRHGLETLVGAKGRALGDIHLEGQAVIKGEIWNVHSISPIAANK
SVKVTRASGLLLEVEEDQSVY
Download sequence
Identical sequences Q5WSJ1
297245.lpl2887 gi|54295797|ref|YP_128212.1| WP_011216799.1.40024 WP_011216799.1.62869 WP_011216799.1.85655 WP_011216799.1.85818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]