SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00000905001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00000905001
Domain Number - Region: 139-222
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00873
Family Adenain-like 0.083
Further Details:      
 
Domain Number - Region: 315-338
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0698
Family Retrovirus zinc finger-like domains 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00000905001
Sequence length 673
Comment (Vitis vinifera)
Sequence
MPYWIRDQEGRLVRIENPQDTELDICVNIMDPPPEDQTSQQGQGGNPNAYLSMRDRMHPP
RMSAPSCILPPLEQLVIRPHIVPLLPTFHGMESENPYSHIKEFEEVCNTFREGGASIDLM
RLKLFPFTLKDKAKIWLNSLRPRSIRNWVDLQAEFLKKYFPTHRTNGLKRQISNFSAKEN
EKFHECWERYMEAINSCPRHGFDTWLLVSYFYDGMSSSMKQILETMCGGDFMSKNPEEAM
DFLSYVAEVSRGWDEPNSREKGKFPSQQTQNPKAGMYMFSEDMDMKAKVATIARRLEELE
LKKMHEVQAISETQAHAMPCTICQSCDHVVDECPTMPAVREMLGDQANVVGQFRPNTNAP
YGNTYNSSWRNHPNFSWKPRPPPYQPQAQTQAPQQTSSGNQLPIAPKDRESVITLRSGKE
VDQPLPKVRQDKELIIEPEPRIVIKEDMMKKHMPPPFPQALHGKKEIKNSSEILEVLRQV
KVNIPLLDMIKQVPTYAKFLKDLCTVKRGLHVTKNAFLTEQEVCLINTLVEEHCDKNLEK
SLNESLEVLEDGFPEPSDVLAIMSPWRRREEILPLFNQEDSEGVAVEDPPKLILKPLPVD
LKYAYLEDDEKCPVVVSSALTNDQEDNLLGVLRKCKKAIGWQISYLKGINPLVNAEEINF
STFSSSIAWEKGD
Download sequence
Identical sequences 29760.GSVIVG00000905001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]