SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00000981001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00000981001
Domain Number 1 Region: 609-724
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-31
Family FKBP immunophilin/proline isomerase 0.0001
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00000981001
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0209
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 240-319
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.051
Family Nucleoplasmin-like core domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00000981001
Sequence length 726
Comment (Vitis vinifera)
Sequence
MSVLEYESRFSELSCFALGMISEEGEKARRFQQGLRPAIRNRLVLLAIRDYFELVKRALL
VEQDIEETNQIREQRGDRKGKQRMGESSQGRSQGPQQRQRTQQSERHSSFYTGGEQSAQR
VAANRVCYGCGAGDHLWRACPLRGVQQARPQSQGSSQQQPVVYFQPPQFQLPYFQMPQVP
PAAQGTRTTTMRSQTRSSQGSNARGRGRQATGRVFALTPTKPEEDVFLVEGIEVKPGKPF
THSFDGQRGRLHISQATLGIGAASKKSLVQCNVGNKSPVLLCCLLPDKTESCTLSLEFEE
VEEVIFSVIGPRSVHLTGYYLGNGRHSNFNEDSESYGEDIADTETEKSNDHGEEDDYEDS
FIDDGELEVFPSSPVSSDGVLLEEKLDGKKTNNGKSSHRRLKKKYQLSESDDDISLQQNI
AKGSAGVLVLESDSEDKIPISSLYKKRGHNKLEDGKGHKDTEEKENAGTEKDGNHSIGSK
RKNNASKKKRKDRSKGVKHLEVDSVNHKNDLKEDKAPQNENKADNMDQNLPERKENQRPN
SYKSCDTKVDQLAGDNQSDEKKIKRKRKKSKTQENEGVANMEVPPLSMNKKSGSHLEVKD
RNSDANSSQVRMMSNGLVIEELITGKPDGKIACQGKKASLFVVYYTGKLKDSGQIFDSNI
GRAPLKFRLGAGKVIKGWDVGLDGMRVGDKRRLVIPPSMGYGNEGAGDNIPPNSWLVFDV
ELAGAR
Download sequence
Identical sequences 29760.GSVIVG00000981001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]