SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00001168001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00001168001
Domain Number - Region: 199-223
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0107
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00001168001
Sequence length 527
Comment (Vitis vinifera)
Sequence
MEEEEGGGIRLSKRLSDKGGEVDYKDKAGTAWSHSYLNQKPWHPLSYPNQRRKWIAEQTH
AQRDRRAQEVAREFAQEQEFFRQTALISKKEKEKVEMMKAVSFMYVRPPGFNAESAKAAE
IADERRRLEQDSPSHDGPSTAMLAKSVAGRNHPGEERKKPRPKDVFGRPLPTEEEFEVLK
NAPRLETGVPARVKPFGVEVRNVKCVRCGNYGHQSGDRECPLKDVIMPNEESRLKRDDPL
TAILAHTDTSEPLKWELKQKPGISPPRGGFKPDDPNQQIVSEDIFDEYGGFLSGENIIPE
LLTNFSSSKPKKRKSSKKGKHKRPSSPTSSQPKDPQQDEAERRSRKDNKHRKKKRNHSES
SSSDDDSEDYGGRRSKKDNKYRKKKQNDSESSLSDNSEDDRERRSKKDNIYKNKKRIQNR
SEPCSSDNSDDNEKRRPKKDDKYRKRRNHSESSSDNPGDDGKRSNKVYNYRKKRNSDYSS
SSDNSQFDRHHKKSRNKHSDRNSSQNIDPDRHYRSKHHHRHHHSHHH
Download sequence
Identical sequences D7TFB6
29760.GSVIVG00001168001 XP_002270679.1.54126 GSVIVT01036870001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]