SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00002259001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00002259001
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-32
Family Canonical RBD 0.00065
Further Details:      
 
Domain Number 2 Region: 106-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000209
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00002259001
Sequence length 207
Comment (Vitis vinifera)
Sequence
MSEHEEYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDDKQA
MEDAIKEMHGMDLDGRSITVDKAQPNQGSGRDRDGDRDRDRGRDRYNDRDRNRDYGGGRG
SNGGECFKCGKPGHFARECPSSEGARGGRYGGRDDKYGGGGGGGSGGRYGPDRNGDRYGG
RSKDAGSRGGSGNDRYSRDRSGPYERR
Download sequence
Identical sequences 29760.GSVIVG00002259001 XP_002264022.1.54126 XP_003634493.1.54126 XP_010664977.1.54126 XP_010664978.1.54126 XP_010664980.1.54126 XP_019072233.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]