SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00003197001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00003197001
Domain Number 1 Region: 399-576
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.1e-57
Family Single strand DNA-binding domain, SSB 0.0000316
Further Details:      
 
Domain Number 2 Region: 252-381
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.71e-29
Family Single strand DNA-binding domain, SSB 0.00017
Further Details:      
 
Domain Number 3 Region: 134-247
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-28
Family Single strand DNA-binding domain, SSB 0.0000684
Further Details:      
 
Domain Number 4 Region: 689-721
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000182
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00003197001
Domain Number - Region: 655-677
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00225
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00003197001
Sequence length 746
Comment (Vitis vinifera)
Sequence
MPSSVDHPGTVLGNPQSFGNSSLTGGSAAKPNMAGVASPYHANSFSSNPDSGRFAGTNAP
PMYSKMQPDAGIPASAASTGSYGDQSTGFRNNKVEVSRAPYNAPARQPQSAYQQPPPMYT
NRGPVARNEAAARIIPIAALNPYQGRWTIKARVTAKGELRHYNNPRGDGKVFSFDLLDSD
GGEIRVTCFNAVADQFYNQIETGKVYLISKGSLKPAQKTFNHLRNDHEIFLESTSTIQPC
FDDDNSIPRQQFHFRSISDVESMENNSVVDVIGVVSFISPSASIMRKNGTETQKRALHLK
DMSGRSVELTLWGNFCNAEGQRLQNMCDSGVFPVLAVKSARVNDFNGKAVGTISTSQLFI
EPDFPEARKLKEWFDKEGRNTPSVSISREVTSMGRTDVRKTISQIKDERLGTSEKPDWIT
VCATVSFIKVDNFCYTACPIMIGDRQCNKKVTNNGDGKWRCERCDQSVDDCDYRYILQFQ
IQDHTGLTWVTAFQECGEEIMGISAKNLYYLKYEEQDDEKFGEILRGVLFTKYSFKLKVK
EEIFSDEQRVKSTVVKAEKVNFSSESRFLLDMVEKHKVEDSTFPLKSENVISNGGMTNPG
LGNVGIRQSTPSVNYSGNASNAGRDFGFPANQGVQHGNQYGSSGLSATGSTGMYQSCNSC
GGTGHSSSNCPSVMHSPRQSSGGGYVSRASTGPSAGGTTGECYKCHQFGHWARDCPGLNT
GPPAYGSSGVNSGSYSSFAKQRVGGF
Download sequence
Identical sequences 29760.GSVIVG00003197001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]