SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00003402001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00003402001
Domain Number 1 Region: 18-108
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-22
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 136-243
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-21
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 3 Region: 245-302
Classification Level Classification E-value
Superfamily EF-hand 0.00000312
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00003402001
Sequence length 306
Comment (Vitis vinifera)
Sequence
MAVINDFQHPSGPRPQFRSPSIVRQGFVLLVVYLLLGIAIYWFNRDDFSADETHPVVDAL
YFCIVTMCTIGYGDITPVSTSTKLFSILFVLVGFGFIDILLSGMVSYVLDLQENYLLRSA
KGVGQRDTGSYIIDVKKGRMRIRMKVALALGVVVLCIGIGVGVMHFVEELDWLDSFYLSV
MSVTTVGYGDRAFKSMPGRIFASIWLLVSTLAVARAFLYLAEARVDKRHRKMAKWVLGQD
MTVAEFLAADIDNNGFVSKSEYVIYKLKELGKVSEKDISQICNKFDRLDSGNCGKITLAD
LMENHH
Download sequence
Identical sequences 29760.GSVIVG00003402001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]