SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00006020001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00006020001
Domain Number 1 Region: 2-593
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.01e-155
Family Prokaryotic type I DNA topoisomerase 0.0000481
Further Details:      
 
Domain Number 2 Region: 741-778
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000119
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 
Domain Number 3 Region: 887-912
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000767
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00006020001
Sequence length 914
Comment (Vitis vinifera)
Sequence
MKVLNVAEKPSVAKAVATILSRNQGLRVREGRSRYNKLFEFNYSIRGQHCQMVVTSVIGH
LMELEFEDRFRKWHSCDPAHLYHAPVRKFVPEDKLDIKRTLEEEARKCQWLVLWLDCDRE
GENIAFEVLEVCAQVNRHIDVWRARFSALIDREIHESVQNLVRPNQLFADAVDVRQEIDL
RIGASFTRFQTMLLRDAFVLDFAADDRNLVLSYGPCQFPTLGFVVERYWEIQSHEPEEFW
TINCSHKSDEGTSTFNWMRAHLFDYTCAVIIYEMCIQEPTATVTKVRQQEKLKYPPHPLN
TIELEKRASRYFHMSSEHTMKVAEDLYQTGFISYPRTETDYFSERTDLHGIVQEQLGHPI
WGSYAQRLLDPGAGLWRNPSNGGHDDKAHPPIHPTKFSAGESGWSQDHQRLYELVVRHFL
ACVSQPAVGAETIVEIDIAGESFSSSGRVIIAKNYLDVYRFESWGGSMIPTYVFGQQFIP
TTLTLDSGVTRPPPLLSEADLLNCMDKAGIGTDATMHDHIKKLLDRFYATKDSNTRFSPT
NLGEALVMGYDDMGYELWKPYLRSMMECDMKAVSIGTKRRNEVLTTCLEQMKACFLDARL
NKVKLLEAMALFFERSNRSSGDEQHEVGDVVRQCTLCQESDMVLRRKPDGNFMVGCLGYP
QCRNVVWLPGSISEAAITTISCNHCTPGPVYKIQFKFRRLEIPPNYNIDHLGCVCGCDEI
LRQLTEICGTGSRISARGRGSNASSTNAQRSNTRQTACIHCSQTGHSSNDCPSRVPRSRN
SQSHRTNMPSGESSIPCNVCGTPCILRTANTENNRGRKFYSCQSQECNFFVWEDSLNSSS
GGRSAQPATARSSASNPSRRGGRGRGDRGRGRQSGARTSDTTFVSATGDPVSGRRCFVCG
DPSHFANVCPNRGM
Download sequence
Identical sequences 29760.GSVIVG00006020001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]