SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00009203001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00009203001
Domain Number 1 Region: 487-592
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.73e-26
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 322-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.85e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00009203001
Domain Number - Region: 426-477
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000802
Family Retrovirus zinc finger-like domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00009203001
Sequence length 751
Comment (Vitis vinifera)
Sequence
MEKHEASYLSRIRKKYSIEVDKPTKVTTVELRAQCVLQSFLDRDNDESEEWELDEFVSLS
HYNDEKEQPIEDPDMDSLGKSVSKSSSDSDPDEAEARLEAISRSLIENKGSLDVIANEPA
PLQDFQTLKKCKQDESSNLEADVGSVVADLHDKSGVPMAPVTDESTSEKQEHAGSSGKRR
LSRRDQKPEVDGETDEGNRTRKRRKTRWTGDDSQLKILGPIQLPSFVKDFVTSDLDPEIQ
ELKVELFEINSKLQRPELHDDRPKEDRSPSPEPVYDYLGNRKNTREVRLREKLIKKRQCI
ISRLIEKNSTFKPAADYKPPKLIKKLYIPEKEYPDYNFVGLIIGPRGNTQKRMEKETGAK
ILLRGKGYSLKTPRRTKASDNEDLHVRIEADNQNSFDAAVRMVEKLLIPIDRGINAHQQA
QLVELGKLNGERNKNMCRCCYDEGHPHYACPHLQSTFQSSLSCDICGSNNHATPSCPLIA
SSQGSNSLWGSSGLEIGSTPDTQSKPNKETSDADLYVGYLPQTMDENCLAELFAPFGKIA
KTKVIKDRATGISKGYGFVKFENPAHAALALSHMHGYKIDGKTLAVREGTRQWVTGSSVL
SPDPNHPGSIAASQDAVRQTGFPVPPGSLLPQHQTMFPETKRMALPPPATYHLGPFDFFP
KSKGLGFPPVSSILNSQGRSGFEYGYIATQVPFSSPSSLLQFPGDPSYPGSQFKSYFATE
TSNPSSSFKISPTPGSNLKPIPWPITHLTQW
Download sequence
Identical sequences 29760.GSVIVG00009203001 XP_002263312.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]