SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00009540001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00009540001
Domain Number 1 Region: 520-562
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000379
Family Retroviral integrase, catalytic domain 0.052
Further Details:      
 
Domain Number 2 Region: 207-252
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00009540001
Sequence length 1377
Comment (Vitis vinifera)
Sequence
MAGSQKASGSENKTIDPSHPLYIHHSDQPGHVLVPIKLNGVNYQSWSKAVIHALTAKKKI
GFVDGTVEEPSQEDEPFMFEQWNQCNNMILSWLTHAKSIATMSQGTMTVAAYFTKIKALW
DELETYRSPLTCNQRQAHLEQREEDRLMQFLMGLDESYKVVRSNILMMSPLPNVRQAYSL
IVQEEMQRQVSSEPTENFSIATAVPRKGGNPRQKMCDHCNRSGHAVDECRTLKFHCKFCD
KRGHTEDRCRLKNGSNNKTGQFRGQRPFGRGNQPLANATKSQEMSDSTSSSTVQGFTTEQ
IQQLAQAIRALNHSNSGNIDAYANAAGLIPSTLMSVNSSSTSSWILDTGATDHIVSHMSL
FTDLKPSNVTTVNLPNGATSPITHTGTVIFDSQLTLKDVLCVPSFNLNLISASKLAKDQN
CCIIFFPDYCILQDLVSGKMIGSGKQRGGLYYMHPSTNKSVVFHVSQPSDLWHLRLGHPS
FSRFKLLSHLLPDIHKELGNHCPICPQAKQTRLPFPKSSITTKFPFSLLHCDVWGPHKIP
AHTGSRYFLTIVDDFSRCTWIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILT
Download sequence
Identical sequences 29760.GSVIVG00009540001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]