SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00010702001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00010702001
Domain Number 1 Region: 634-948
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 221-303,335-366
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-28
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00010702001
Domain Number - Region: 66-98
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00126
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number - Region: 492-554
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00549
Family Pan module (APPLE domain) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00010702001
Sequence length 968
Comment (Vitis vinifera)
Sequence
MVANGYIFKKGVNAFLSYARKHSRRGDSSKPKPPSKGNQAKGGGDKRSQGHTSKEGSSKG
PSGKDGKGKDKRKEFTPRTNCFLCDGPHWARDCPKRKALNAMIEEKEQEGDAKMGSFSRK
LTNRPFTNSCLCLQMNHCGTWGCGMDASCRCPTAVILFLLSIFYSLPSFCYAANTLTQGQ
SIRDGETVNSSSQHFALGFFSPENSTSRYVGIWYNKIEGQTVVWVANRDSPISGTDGVLS
LDKTGNLVVFDGNGSSIWSSNASASSSNSTAILLDTGNLVLSSSDNVGDTDKAFWQSFNS
STDTFLPGMKVLVDETMGENRVFTSWKTEVDPSPGNYTMGVDPRAAPQIVIWDGSIRWWR
SGHWNGLIFTGIPDMMAVYSYGFKYTTDEDGKSYFTYTPSNSSDLLRFQVRWNGTEEQLR
WDGDKKEWGVVQSQPDNECEEYNKCGAFGICSFENSASCSCLEGFHPRHVDQWNKGNWSG
GCVRRTQLQCDRRDGFLTVEGVKLPDFADRVNLENKECEKQCLQNCSCMAYAHVTGIGCM
MWGGDLVDIQHFAEGGRTTLHLRLAGSELGGKGIAKLVIVIIVVVGAVFLSLSTWLLWRF
RAKLRVYENARKNELPILYVSDFSGSVDLQGSGSELPLFNFKCVAAATGNFSDENKLGQG
GFGPVYKGMLPGGEEIAVKRLSRRSGQGLEEFKNEMTLIAKLQHRNLVRLLGCCIEGEEK
MLLYEYMPNKSLDFFIFDPAKQAELDWRKRFTIIEGIARGLLYLHRDSRLRIIHRDMKAS
NILLDEEMNPKISDFGMARIFGGDQNEANTTRVVGTYGYMSPEYAMEGLFSVKSDVYSFG
VLLLEIVSGRRNTSFRLTEHSNLLSFAWQLWNEGKAMEFVDSSIRDSCSQDEVLRCIKVG
MLCVQDSTIYRPTMSTVVLMLESETATLPMPRQPTFTSTRSSIDLDLFSEGLEIVSSNNI
TLSAVVGR
Download sequence
Identical sequences 29760.GSVIVG00010702001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]