SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00011087001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00011087001
Domain Number - Region: 216-256
Classification Level Classification E-value
Superfamily Fzo-like conserved region 0.0589
Family Fzo-like conserved region 0.0098
Further Details:      
 
Domain Number - Region: 107-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00011087001
Sequence length 471
Comment (Vitis vinifera)
Sequence
MSSSMKQILETMCGGDFMSKNPEEAMDFLSYVSEVSRGWDEPTNREMGKRPVQQMSRVGL
SNDGGSTEMYSLSEDMEMKAKVAAMARKIEEMELRKVHEVQAISEPQQPANPCSICQSFE
HMVEECPTIPAAREMFGEQANLIGQWKPNSNAPYGNTYNSNWRNHPNFAWKPRPNSYQSP
AQSSQQSQGQSSVEQALISLSKVMGDFVSEQKSINSQLNQKIDNVESTLNKKIDGMHNEL
SQKIDNIQYSISRLTNLNTVNEKGKFPSQPHQNPKGIHEVESKDEDSSKVRDVQAIITLR
SGKEVHQPEHDQRKAKEDKADRNEEKKNEQKGKEVQMKESIIPSMDEEPQILLKEGMMKK
HMPPPFPQALRGKKPIKNASEILDVLRQVKVNIPLLDMIKQVPTYAKFLKDLCTVKRGLN
VTKQAFLTEQVSAIIQCKSPIKYKDPGCPTISVNIGGTQVEKALLDLGGKC
Download sequence
Identical sequences 29760.GSVIVG00011087001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]