SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00012059001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00012059001
Domain Number 1 Region: 219-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000549
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00012059001
Sequence length 384
Comment (Vitis vinifera)
Sequence
MATKASIFSSVISGSSMITSEKLVGSENYLSWSASVELWFMGQGYEDHLITQETDIPEVD
RVQWRKIDAQLCSVLWQSVDPRILLHLQAYKTCFKFWTQAKGLYTNDIQRLYKVASAIVH
LSQQDLDLSTYIGQIASLKEQFLTVMPLTPDVGAQQTQLDKFFMVLTLIGLRPDLEPIRD
QILGSSSVPSLDDVFARLLRISSTQTLPSDSTSDFSVLVSQTTSRGGRSGTRGRGQRPHC
TYCNKLGHTRDRCYQLHGRPPRTAHMAQSSDSPLPQPPSSSASQTSQASIASVAQPGNAS
ACLTHTSSLGPWILDSGASDHLSGNKDLFSSITTTSDLPTVTLANGSQTVAKGIGLALPL
PSLPLTSVLYTPECPFNLISISKI
Download sequence
Identical sequences 29760.GSVIVG00012059001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]