SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00013144001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00013144001
Domain Number 1 Region: 17-153
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000811
Family CRAL/TRIO domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00013144001
Sequence length 202
Comment (Vitis vinifera)
Sequence
MCAQASPSEQEQLVEKLEIFKIRGRDKRGRKILRIIGKYFPARTLSVDVVKKYLEDKIFP
KLGKKQFSVLYVHTDVERSENFPGISALRSIYEAIPVNVKENLEAVYFVHPGLQSRLFLA
TFGRLLLGGGLYGKLRYVNRLDLLWEHVRRNEIEIPDFVYDHDEELEYRPMMDYGLESDH
PRVYGAPAVDSPVSMYSMRCIS
Download sequence
Identical sequences D7TV30
29760.GSVIVG00013144001 XP_010646839.1.54126 XP_010646840.1.54126 GSVIVT01006259001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]