SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00014324001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00014324001
Domain Number 1 Region: 243-345
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 5.49e-32
Family S-adenosylmethionine synthetase 0.000054
Further Details:      
 
Domain Number 2 Region: 346-416
Classification Level Classification E-value
Superfamily S-adenosylmethionine synthetase 1.26e-27
Family S-adenosylmethionine synthetase 0.00015
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00014324001
Domain Number - Region: 79-111
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00014324001
Sequence length 509
Comment (Vitis vinifera)
Sequence
MIACQRWPCIKHFLLALTITVLSPLIEFTVEDFPTPPFPITRIIIVLSFSCFNFPNSSRP
FLYSASELFSISVAECSEGTTSRTVLDGMKCSHCGNQRHTSENCLKKYGYPDWWYELQAK
KKDSAGADKNKGKVAIMLVEPHISLIPQVESSQDAGPVFDIATDHMTFATTDFTMTSPLR
CTSVANANGVVSPVTGAGSVYLSHSLQLSNTLLVPLPSHKLLSISQDILTKEIIGRGTKR
RGLYYMEDVSIGHVHQIQSDISDAVLDACLTQDPDSKVACETCTKTDMVMIFGEITTKAN
IDYEKIVRDTCRTIGFVFYDVGFDVDNCKVLVNIGQQSPNITQDVQGISAGDQGHMFGYA
TNETPKLMPLSHVLSTKLSARLTEVRKNETCSWLRPDGKTQVTVEYHDENGAMAPFVYTL
FSSPPSMMRLSLMMRFLLISKSMSSSLSFLRSTLMRSPSSLLTHLLMASMSDWHYATYNN
RRDETQILNGFGNGLVTYREGTVKTVAHF
Download sequence
Identical sequences 29760.GSVIVG00014324001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]