SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00015337001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00015337001
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.64e-21
Family Cold shock DNA-binding domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 156-187
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000101
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Domain Number 3 Region: 89-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000432
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00015337001
Sequence length 189
Comment (Vitis vinifera)
Sequence
MAESKRSTGTVKWFSGQKGFGFIAPDDGGEDLFVHQTSIRSDGFRTLSEGETVEFAVDHG
EDGRTKAVEVTAVRGSYSSGGGGGRGFSGGRSRGGNDGYGGGGACYNCGRTGHLARDCYQ
GSGGGRRGYGGGGGYSAGAGGGGYSAGAGGGGYSAGAGGGGYSFGAGGGACYNCGEEGHF
ARDCPNGQK
Download sequence
Identical sequences 29760.GSVIVG00015337001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]