SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00016327001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00016327001
Domain Number 1 Region: 384-470
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000546
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00016327001
Domain Number - Region: 237-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000164
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00016327001
Sequence length 484
Comment (Vitis vinifera)
Sequence
MEESSLTVAPSILDGDNYEIWAVRMTVHLQALDVWEAVEENYEVPPLGANPTVAQMKLHK
ERRTRKAKAKACLFAAVSPSIFIKIMKIDSAAEIWGYLKEEYKGDERIKNMQVMNLIREF
EMKKMRESDAVKDYAAQLLSIADKVRLLGKEFSNEKIVQKILVTLPEKYEATISSLENSK
DLSTISLTELLHSLEAVEQRRLMRQGDTAEGAFQARMQKNACHKNGKVNNNKSCGNNQKN
GVFPPCPHCKKTNHSPQKCWWRPDVKCNKCGKQGHVERICKNQQQEETNAVVDYCQEEQL
FAATNCIIKDAEGKEVFNIKMKGKSFALNLLEDEHTAILQQDSTTMFWDRRVEHFHHDDV
LYIKKNQIVEGLPDLEKDLPICATCQYGKQTKLPFPKKISWRATQKLQLVHTDVGGSQKM
PSLKWNANNVHQLTAPYNPQQNGAVYFLNILPTKVLKKQTPFEVWFECLRARLGVCIYEV
KEEC
Download sequence
Identical sequences 29760.GSVIVG00016327001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]