SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00017251001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00017251001
Domain Number 1 Region: 625-657
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000607
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00017251001
Domain Number - Region: 2-135
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0889
Family Type II DNA topoisomerase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00017251001
Sequence length 693
Comment (Vitis vinifera)
Sequence
MDKGKGKEFIIDLNDENFDYQYDSIVKTESDEVAILVSNKIFNDLTLEYVWKMEFSLVKE
AKEFYNLFAKVTGFSVRKDDVKRDKNQNIVSRKWVCLKEGYRHKVCLENENRKQEPKAVT
RVGCETTFRIGFNKQMNKWVVKEFMADHNHPLVEQKNVQFLRSHRVIKNADKAQLNAMRG
VGIGTSQIMDYMVQQSGGYNNVGFTKKDLYNHVDADRRVHLRDGDAEGALAYLCGKSEMD
PSFYYKYNTFLDAINNKKPLSVITDGDKAMRKAIRRIFPYSCHRLCAWHIQRNAFTNVHV
KDFTNHFSKCMFMEDTVEEFECAWNDMLEMFNLHGHKWVTDIYAKRSRWAEAYLRGHFFA
GMKSTQRCESMNAYLNRFLKTRLKLFEFVKHFDRALSRIRHNEAKAKFESHHSPTVLTTK
LYALEKYAGTVFTRQSFLKFRDEMKNAELFFPVSTENHGGYRVHTLTKFRSPDKIWKVCY
GNSDRSMKCTCMMFESVGFPCPHMIVVMKIEHLKEIPETCIMKRWSKLAKETVQVHHDNE
SQGDATNSIRYGALSSMCSRMSYFASQSEKAFKEARCEIQRLICQMEELCKNSVEESEQE
DLKAIKHHVRDPIIVKTKGNPGNLKDKFKKPRHCGKCKKVGHTVRKCPEFVNTHNAFINI
EDSIEDMVCSNTYSLNSLIIHFIVIFIWLNWLK
Download sequence
Identical sequences 29760.GSVIVG00017251001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]