SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00017443001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00017443001
Domain Number 1 Region: 170-213
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000306
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 2 Region: 291-339
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000201
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 3 Region: 213-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000967
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00017443001
Domain Number - Region: 330-421
Classification Level Classification E-value
Superfamily Phage tail proteins 0.0595
Family Baseplate protein-like 0.015
Further Details:      
 
Domain Number - Region: 261-279
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0733
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00017443001
Sequence length 482
Comment (Vitis vinifera)
Sequence
MGRRQKPKAKIDHQEDEEGANSSRSVIYLSSSDDEEANEDLSLKIVEKAMKRASKTDHND
AVLAGRSAVIDLGSSPSEEAEVITDRSGPTTDDDAEVKSKKKKSRKEKRANKNIENQEKT
DEILMEEKKGESDKALEILKMVEPYPVEGSDNIVLRKLLRGPRYFDPPDSGWGACYNCGE
EGHNAVNCASVKRKKPCFVCGSLEHNAKQCMKGQDCFICKKGGHRAKDCPEKHRSGSQNS
KICLKCGDSRHDMFSCRNDYSPEDLKEIQCYICKSFGHLCCINYVDTGPIEPSCYKCGQL
GHTGLACARLNAETADVQTPSSCYRCGEQGHFARECKSSTKVSKRYSEVSTQSRRFLKED
KDKLGFKSAPKDLGMGRKRKKPWYEERGNITPRKPKQRGGWITEDPGDSPQRKAKVKSWR
SPATPTNKNHKRPMLTAGHYTSSQSSKNTQKLLSIDFLQIQSCSFACALVRARFLAFSPC
SC
Download sequence
Identical sequences 29760.GSVIVG00017443001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]