SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018045001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018045001
Domain Number 1 Region: 419-480
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000106
Family Retroviral integrase, catalytic domain 0.039
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00018045001
Domain Number - Region: 153-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000102
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018045001
Sequence length 493
Comment (Vitis vinifera)
Sequence
MHSCVVYYGNRLIPEFFFIFRPIKLVLNFGLRPKGLYTNDIQRLYKVASAIVHLSQQDLD
LSTYIGQIASLKEQFLTVMPLTPDVGAQQTQLDKFFMVLTLIGLRPDLEPIRDQILGSSS
VPSLDDVFARLLRISSTQTLPSDSASDSSVLVSQTTSRGGRSGTRGRGQRPHCTYCNKLG
HTRDRCYQLHGRPPRTAHMAQSSDSPLPQPPSSSVSQTSQASIASVAQPGNASACLTHTS
SLGPWILDSGASDHLSGNKDLFSSITTTSDLPTVTLANGSQTVAKGIGLALPLPSLPLTS
VLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSS
PAICISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCESCQLGKHTRVSFPKRLNNR
AKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLMKNRAELFSIFQKFYTEI
QTPVQYFYSCVTQ
Download sequence
Identical sequences 29760.GSVIVG00018045001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]