SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018088001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018088001
Domain Number 1 Region: 117-155
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000733
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018088001
Sequence length 397
Comment (Vitis vinifera)
Sequence
MIKLYLANDVMYHVMDEESPVTIWLNLESQYMSKLLTNKLYLKQKLYGLKMVEGSDLSQH
INVFNQIISDLKRIDVKFENKDKTLMLLNSLPASSTYEILRKKANDESSQGEGLFQSESS
NNKSRSKSNKRKDIQCYKCRKKGHMKRDCPKKKKRGSVSENKEDSSKSMNVLAEEDSESG
DGDMLSVSSNSNHLTDSWILDSACSYHMTPNNDWFNTYRSINSSSIQMGNDASCKVVGIG
NIKIKMFDGVVRTLCDVRHIPDLRKNLISLGTLNCNRFSYKSTSGVMKMSKSSMTVMKGQ
KLAGNIYKLLCTTIVGGVATVEPKSDSTIMWHMRLGHMGERWMMELHKRNLLKGIKTCKL
DFCKYRVFWKQNKVQFKTATHKTNGFFYYVHIDIWDQ
Download sequence
Identical sequences 29760.GSVIVG00018088001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]