SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018411001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018411001
Domain Number 1 Region: 218-300
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-28
Family Canonical RBD 0.00015
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00018411001
Domain Number - Region: 148-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018411001
Sequence length 301
Comment (Vitis vinifera)
Sequence
MALVDRSGSGWNSNPPKAEKIRWGELDEDDGEDLDFLLPPRQVIGPEENGIKKVIEYKFN
EDGNKVKITTTTRVRKLAKARLSKRAVERRSWAKFGDAVHEDVGSRLTMVSTEEILLERP
RAPGTKAEETKIAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPYKDLAAQTDAFVDKP
PAAETTVATTGTGKAAYVPPGMRPGAERVGSDMRRRNEENSVRVTNLSEDTREPDLHELF
RTFGPVSRVYVAIDQKTGMSRGFGFVNFVNKEDAERAINKLNGYGYDNLILRVEWATPRT
N
Download sequence
Identical sequences F6HNT9
29760.GSVIVG00018411001 XP_002282439.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]