SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018562001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018562001
Domain Number 1 Region: 1681-1784
Classification Level Classification E-value
Superfamily Bromodomain 3.4e-27
Family Bromodomain 0.00026
Further Details:      
 
Domain Number 2 Region: 596-696
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.75e-16
Family Ubiquitin-related 0.0021
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00018562001
Domain Number - Region: 1362-1398
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00419
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 0.0471
Family TAF(II)230 TBP-binding fragment 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018562001
Sequence length 1798
Comment (Vitis vinifera)
Sequence
MFGNVDGAGDLDYNYVFQDAKEHLAALADKLGPSLTDIDLSVKSPQTPADGAEQDYDEKA
EDAVNYEDIDEQYEGPEIQAATEEDYLLSKKEYFSADVSVASLDHSASVFDDDNYDEDEE
FEKEHEVVDNNSEVQAISSVGIWCCAYCHKYTHFAYATICPLFEEPEGLEEPFEGKRSAP
LPILCVEDGMVILRFSEIFGIHGPLKKGEKRDRRYTIPKERYKSMDAPDNVEEDEEAFLK
GGCQAFSFTKHKLLTQDDASVFMEDEAELKKVGVVQGTATMELQNDEQRKHSCISAEPMK
EDMPVDLSEFWLSPLSPKFYPLDQQDWEDKIIWDNSPEVSDNSAESCEISGPDSEVVVDK
ETELVTKAQNQRPKFQVAVDEKDHGVFLGSSPVLIEAFGSRNSSALINHSLSEIKYHPQL
LRLETRLEMDNSSQSAVRKEDAIEDPRGSEAIRRFNKLTLQNRDMLEGSWVDRIIWEPHK
PISKPKLILDLQDEQMLFEILDDKDGKNLGLHAGAMLITRPVKSSTGDSIELPVHGGPSG
GRFNIANDKFYLNRKTSQQLKSHSKKRTAHGVKILHSIPALKLQTMKLKLSNKDIANFHR
PKALWYPHDIEMAVKEQGKLPTQGPMKIILKSLGGKGSKLHVDAEETVSSVKLKASKKLD
FKPSEMVKIFYTGKELEDHKSLAAQNVQPNSLLHLVRTKIHLWPRAQKLPGENKSLRPPG
AFKKKSDLSVKDGHVFLMEYCEERPLLLGNVGMGARLCTYYQKSAPGDHTGAFMRNGNSS
LGTVLTLDPADKSPFLGDIKPGCSQSSLETNMYRAPLFPHKVSSTDYLLVRSAKGKLSIR
RIDRIDVVGQQEPHMEVMSPGTKGLQTYIMNRLLVYMYREFRAGEKRGSLPCIRADELSA
QFPNISEPFLRKRLKHCADLQKGSNGLLFWVMRRNFRIPLEEELRRMVTPENVCAYESMQ
AGLYRLKHLGITRLTLPTGLSSAMNQLPYEAIALAAASHIERELQITPWNLSSNFVACTN
QDRENIERLEITGVGDPSGRGLGFSYVRTAPKAPISNAMVKKKITVGRGGSTVTGTDADL
RRLSMEAAREVLLKFNVPEELIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQ
RMSFLQLQQQTREKCQEIWDRQVQSLSAVDSDEIESDSEANSDLDSFAGDLENLLDAEEC
EDGEEGNCESKHDRTDGVRGLKMRRRPSQAQAEEEIEDEAAEAAELCRMLMDDDEAERKK
KKKTRPVGEEEGLALGSQLNFGFENGQKMKKNSAVVKQLVSKVQPDGSYSQKEKAFRDSK
EVESFLPKRNISGKAKILKKNDAARMGVLHKKIKIMGDGIKMFKEKKSARESFVCGACGQ
LGHMRTNKNCPKYGEDLEAQVEITEPEKASVKSSSLEHSAQLQQRTLIKKIIPKSATKMA
LVETSEGEKSSLKAKNLPVKFKCGSADRLPDKVAPGTTHGPDQPVISDAETGNKFVKKII
IKRPKEISLDQVSQDGSTGLEYRKTKKIVELSSFEKHKKPETKHLNEDAAKRKAREDKRL
WEEEEKRRNAERLREERAKRLYEEEMRMLEEQERLAEIRKFEEAIRREREEEERQKARKK
KKKKMPEMRDNHLEDYRTRRNDRRIPERDRSTKRRPVVELGKFGADYGPPTKRRRGGEVG
LSNVLESIVDSLRDRYEVSYLFLKPVSKKEAPDYLDIIRDPMDLSTIREKVRKMEYKNRE
DFRHDVWQITYNAHKYNDGRNPGIPPLADQLLELCDYLLSENDASLTEAEAGIEYRDT
Download sequence
Identical sequences 29760.GSVIVG00018562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]