SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018586001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018586001
Domain Number 1 Region: 76-321
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.17e-22
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00018586001
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily EF-hand 0.000106
Family Polcalcin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018586001
Sequence length 374
Comment (Vitis vinifera)
Sequence
MTYLSLPKISREDFELIFDELDDSNDFKINLDEFFDLCNAITLSFQKEDSQSWFERYPSF
YHSPACEKLKAFVRSSIFGNMIAVILVLNLVAVIIETTLDIENNSAQKVWQKVEFVLGWI
YVLEMALKVFAFGFKNYWRDDSNRFDFFITWIIVIGETATFVAPSSLSFLSNGEWIRYLL
LARMLRLIRLLMRVKQYRAFIATFLNLIPSLMPYLGTIFCVLCIYCSLGVQIFGGIVNNG
NSNLEGTDLEESDYLLFNFNDYPNGMVTLFNLLVMNNWQVWMQSYKDLTGTSWTLVYFIS
YYLLTVLLLLNLVVAFVLEAFFAEMDLEKSENCGEDGKEAGEKQRRYTRSRIRSQRVDIL
LHHMLSAELNQTES
Download sequence
Identical sequences 29760.GSVIVG00018586001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]