SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00019562001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00019562001
Domain Number 1 Region: 494-653
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.18e-34
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00019562001
Domain Number - Region: 243-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00398
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00019562001
Sequence length 741
Comment (Vitis vinifera)
Sequence
MALNTTSRTNVSLISSTSCFDGIISINATAQLPIKLNNNNFPSWKAQFDALLYGYDLMGF
LDGNKTCPSKEIIAEDGTTVSNPDFVIWTRQDKLPLHAILASLSEGVVPLIAAATSSRDA
WVKLHKLYANKSRSRVMNLKEKLTNITCNTRSVAEYLQTIKGIADELALIDTHLSDDDLT
IFALNGLGSGFKEISAAIRARETPISFEELHDKLVEHETFLKREESRGGSNVTVNSTRTS
RKFNNNGNHNNHFQSNVVCQFCQKKEHTARQCHSARRLLQQQPEVHHTSFGNSSSSNWIL
DSGASHHVTGDLTNLSHQQPYEGPDDILLGDGSGLEITHTGSSKLSATSKSFCLSNVLCV
PSIKQNLISVSKFCKTNNTSIEFFPSSFVIKDLKTGARLTQGRSKDDVYEWPWPNKGNTL
GTSPKQACVSVKTSLANWHHRLGHPSSRIFQFLIRKHNLQIYPTESFHNFFCESCLCNKS
HKLPFGVSSLRSRGSLDLVYSDVWGPSPIESIDGFRYYLIFIDYFTKYVWLFPMAYKSDV
YTIFPKYKSMVEKYFNASLVTLYTDGGTEYKSLKSYFISQGIQHQVSPPYTPEHVGSAER
KHRHVVETGLAMLHKASLPLKYWSYAFLAAAYLINRLPTPILKHQSPFESLFQHMPNYDK
LRAFGCLCFPWMRPYFDHKLDKRSKPCVFLGYSNTHNAYKCLDLSSNRVYISRHVQFIEH
KFPFASNTTPTDLDQAISTWS
Download sequence
Identical sequences 29760.GSVIVG00019562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]