SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00020140001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00020140001
Domain Number 1 Region: 471-595
Classification Level Classification E-value
Superfamily Plus3-like 3.79e-24
Family Plus3 0.0016
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00020140001
Domain Number - Region: 405-435
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000236
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 
Domain Number - Region: 363-389
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00106
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00020140001
Sequence length 597
Comment (Vitis vinifera)
Sequence
MYRHRTKGKGKALSDGDRSGRKSNKEDDSDESVESCNSAALFSTGKKRWGYEQQLITGSK
RIRKQINGSPGSTSFVRQDSSFMSWISNMMKGLSKSNQDETPSLALTLARPNHDNYDQKL
VTCNKNQDPGCRNIGFQSIFQSLYCPTTKVQESRTLNADNQTGEGSKEFCLANKLCDFNQ
STFGNRAGPSTQPKVLSAKFAVSQENYKTSSVENRSASNPVSSSSSLGKRKANSAENNDS
DPPSEGKTIHNFGYKSDLLGSLWVTRFSPKTSSPTCKVDHCNQNTGGATELSTDCMGLIP
YSQNRTEVSFGFKKNNAHNNQNSIYKLNPISPSQRFKSSEAMASLFARRLDALKNIITLN
QTDTEARATPTCFFCGIRGHSIHDCSEIKETELEDLLRNNNLYPGAEEPPCFCIRCFQLN
HWAVACPSVLKRQNQSECGASLVNRCSSESQIIPLCNFVNPQISDVPKGIFDAIKRLRLS
RGDILKWMNSVFPFSHLNGFFLRLRLGKWEEGLGGTGYYVACISGAQKERPSQSSKNPIA
VNIGGVKCLVQSQYISNHDFLEDELMAWWGATTRAGGKIPSEEDLKVKLEERKKFGF
Download sequence
Identical sequences 29760.GSVIVG00020140001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]