SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00020229001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00020229001
Domain Number 1 Region: 326-433
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000689
Family Reverse transcriptase 0.015
Further Details:      
 
Domain Number 2 Region: 223-248
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000224
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00020229001
Sequence length 437
Comment (Vitis vinifera)
Sequence
MHAFTNNGWWDNYLTFEDRNGILKAYRINEENEVVKDEDGQDIEDVVATLIYSISKHFIG
DPAKIKDKIVDLLTNLKCPKLHDFRWYREVFLTKVILRSNYNQSFWKEKFILGLPRLFSE
RIRIKIREQFNGQIPYDKLSYGEIISIVTSEAIKLCNDFKLKQQMKNEQRIYKNEFVSTK
PSKEKSYHNKRGTHGNYRMNETKKQRHIQRMMNKEAHKKLEAPSQSKPVCFKCGKIGHYK
KDCRVKQKINNLNVTEDLKDMLCKVMLNSTESESRIDSDNENGINQLDSSGEEISSQTSS
DQEEYIKDNCDCQPKTINVISQDQELVLDNIPTKSRPIQMNKGLLSYCDKEIWDLLDKKL
IRKSKSLWSCSTFYVQEQVESEKGTPRLVVNYMPLNDTLSWIRCPIPNKTTFVVSLGHYE
WFIMPFDLKNAPQNSRI
Download sequence
Identical sequences 29760.GSVIVG00020229001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]