SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021176001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021176001
Domain Number 1 Region: 556-827
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.13e-41
Family Hypothetical protein VC1974 0.0015
Further Details:      
 
Domain Number 2 Region: 271-493
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.3e-38
Family D-glucarate dehydratase-like 0.00069
Further Details:      
 
Domain Number 3 Region: 116-249
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.0000000126
Family Enolase N-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021176001
Sequence length 844
Comment (Vitis vinifera)
Sequence
MLLILPLAMIMDLSIVFVHIHYTIETILVYFIEKITNFCSMKHLEVRTKIELQDALFTSQ
QENRDCVIEVESCIDSNAAFHSTLRKFACQAADHALNMLSKFSIPDFIFHGSFLCKIHGM
EYSIYRIPLCAPPTSASVNYKTTTFYRDGFILILSLEGGHVGFGEVAPLEIHEEDLLDVE
EQLRFLHHVIKGAKISFYLPLLKGSFSSWIWSCLGIPPSSIFPSVRCGLEMAILNAIAAQ
EGSSLLNILHPYKVEEEISERSKRVQICALLDSNGSPLEVAYLAKTLVEEGFTAIKLKVT
RRADPIEDATVIQEIRKMVGLQIELRADANRNWTYEQAIQFSSYVKNCDLKYIEEPVKDE
DDIIKFCEETGLPVALDETMDKIGETPLQKLAKFSHSGIVAVVIKPSVVGGFENAALIAR
WAQQQGKMAVVSAAFESGLSLSAYIQLSSYFELQSAEICKLMNKQLVPSVAHGLGTYRWL
KEDVTFEPLSINRSQDSGFIEASVVDADRILQKFQINRDTIIRIFSEEQVYTHQLAVDSD
GFSCLLNVHEIGASIENDVVVFLHGFLGTGGDWIATMKAISGSARCISIDLPGHGGSKIQ
NHDGKEDVLEPNLSIEVVADVLYKLIHSITPGKVTLVGYSMGARIALYMALTSSFSDKIK
GAVIISGSPGLKNDEARKIRMVKDDSRSHALITHGLQIFLESWYSGELWKSLRGHPQFNQ
IVASRLQHKDVRSLAKTLSDLSIGRQRPLWEDLRQCSTPLLLIVGEKDGKFKRIAQEMCY
EIGHGTSNGDDSRKEIYEIVEVPNCGHAAHLENPLPIIRALRRFLTGLENSSTPNERAVP
FHGS
Download sequence
Identical sequences 29760.GSVIVG00021176001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]