SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021265001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021265001
Domain Number 1 Region: 6-30
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000536
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021265001
Sequence length 291
Comment (Vitis vinifera)
Sequence
MEKSGAAPTGCYKCGRPGHWSRDCPSSNTNPNPNPNPNPNSQNQYSSFNKGTASKPLAKS
SEKPKKAPRTRPNLTPELLLSDNGLGYVLRHFPGAFKFRGRGHEVSDLGNLIGLYSEWHS
HLLPYYSFDQFVHKVEKVGTTKRVKICIRELRERVENGGDLTKFHEPPVEHEDCPNHDQG
LPATEEVMNSVDPSHYQGDTSLNHEDVQEDMLHEVYRSATEEPSQTLASDMVAGDVPSEG
SSKKELPNQVPENGPIRSDIQITEEQKARMEANRQKALERAAARVRLQQAV
Download sequence
Identical sequences D7TAF5
29760.GSVIVG00021265001 XP_002272919.1.54126 GSVIVT01010231001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]