SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021377001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021377001
Domain Number 1 Region: 197-292
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-27
Family Canonical RBD 0.00028
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00021377001
Domain Number - Region: 35-80
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 0.0589
Family Translation initiation factor IF3, C-terminal domain 0.0064
Further Details:      
 
Domain Number - Region: 140-159
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0701
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021377001
Sequence length 293
Comment (Vitis vinifera)
Sequence
MVIDAAPQPNKVRWGELEEDDTEDLDFLLPPPQVIGPDDNGIKKVIEYKFNDDGDKVKIT
TTTRVRKLANARLSKRAVERRSWPKFGDAIHEDVGSRLTMVSTEEILIERPRAHGSKAEE
TNTVGGDSLAQLTKGGAVLMVCRTCGKKGDHWTSRCPYKDLAPQPEAFIDKPTASDPTAA
ASVTKGAYVPPSMRAGADRSSGTDMRRRNEENAVRVSNLSEDTHEADLRELFSRFGQLTR
VYVAIDHKTGLSRGFGYVNFVNREDAERAISKLNGYGYDSLILQVEWSTPRPN
Download sequence
Identical sequences F6HL74
29760.GSVIVG00021377001 XP_002272361.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]