SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021930001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021930001
Domain Number 1 Region: 484-527
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000809
Family Retroviral integrase, catalytic domain 0.043
Further Details:      
 
Domain Number 2 Region: 220-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000968
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021930001
Sequence length 531
Comment (Vitis vinifera)
Sequence
MATKASIFSSVISGSPMITSEKLVGSENYLSWSASVELWFMGQGYENHLVTQEVDIPEVD
RVQWRKIDAQLCSVLWQSVDPKIFLHLRAYKTCFKFWTQAKGLYTNDIQRLYKVASAIVH
ISQQDLDLSTYIGQIASLKEEFLTVMPLTPDVGAQQTQLDKFFMVLTLIGLRPDLEPVRD
QILGSSSVPSLDDVFARLLRISSTQTLPFDSTSDSSVLVSQTSSRGGRSGTRGRGQRPHC
TYCNKLGHTRDRCYQLHGRPPRTAHVAQSSDSPLPQPPSSSTSQASVASVAQPGNASAFL
THTSSLGPWILDSGASDHLSGNKDIFSSITTTSALPNVTLANGSQTVAKGIGLALPLPSL
PLTSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLT
SDSSPAVCISTDAPLLIHNRLGHPSLSKFQNMVPRFSTLSSLPCESCQLGKHTRVSFPKR
LNNWAKSPFELVHTDVWGPCRTTSTLGFQYFVTFIDDYSRMYLVIFNDKSS
Download sequence
Identical sequences 29760.GSVIVG00021930001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]