SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00022481001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00022481001
Domain Number 1 Region: 188-472
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.12e-70
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 737-761
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000767
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00022481001
Domain Number - Region: 547-621
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.032
Family GUCT domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00022481001
Sequence length 762
Comment (Vitis vinifera)
Sequence
MASSIIGVSSVYQTTALELSRRTSAHSLSLPFSDKTHLGVFKAPNTRVLSDASLRRSFKQ
GISFVPSAIATPNSVLSEEAFKGLGGFSKDPLDVTDTDDDYDPEIEASAAAQEDELALAQ
LGLPPRLVESLEQRGITHLFPIQRAVLVPALEGRDLIARAKTGTGKTLAFGIPIIKRLSE
DDEKRTSQRVLVLAPTRELAKQVEKEIKESAPYLSTVCVYGGVSYITQQNALSRGVDVVV
GTPGRIIDLIKGNSLKLGEVQNLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATM
PAWVKKLARKYLDNPLTIDLVGDHDEKLAEGIKLYAIPTTATSKRTILSDLITVYAKGGK
TIVFTQTKRDADEVSMALTNSIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARG
LDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVKSLERDVGCKF
EFISPPAIEEVLESSAEQVVATLNGVHPESVEFFTPTAQKLIEEKGTGALAAALAHLSGF
SQPPSFRSLISHEQGWVTLQLTRDSGYSRGFLSARSVTGFLSDVYPTAADELGKIYLVAD
ERVQGAVFDLPEEIAKELLNKQMPPGNTISKITKLPALQDDGPAGDYYGRFSNRDRSSRG
GSRERRGSRISRGRGSSWGSDDDGGDDLNRRGGRSFRSNNNWSRNLRTSEDDWLIGGRRS
NRSSSSFGSRERCYYDRSFGGSCFTCGRSGHRASECPNKRDY
Download sequence
Identical sequences 29760.GSVIVG00022481001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]