SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00023771001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00023771001
Domain Number 1 Region: 513-633
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00023771001
Sequence length 652
Comment (Vitis vinifera)
Sequence
MGNGDYKYPATGVECAHRVAVPPPQPFTKSLKTSLKETFFPDDPLRQFKNQPASRKFILG
LQYFFPILEWGPRYSFQFLKADLISGITIASLAIPQGISYAKLANLPPILGLYSSFVPPL
VYAMMGSSRDLAVGTVAVGSLLIASMLGNEVKANEHPQTYLHLAFLATFFAGVFQVSLGL
LRLGFVVDFLSHATIVGFMGGAATVVCLQQLKGILGLDHFTHGTDIVSVMRSVFTQTHQW
RWESGVLGCCFLFFLMLTKYFSKRRPKFFWVSAMAPLTSVILGSLLVYLTHAERHGVQVI
GNLKKGLNPPSLSDLPFGSPYLSTAIKIGIIIGIIALAEGIAVGRSFAMFKNYHIDGNKE
MIAFGMMNIAGSCTSCYLTTGPFSRSAVNFNAGCKTAVSNIVMAMAVMITLLFLTPLFHY
TPLVVLSSIIIAAMLGLIDYDAAIHLWKVDKFDFIVCIAAYIGVVFGSVEIGLVLAVAIS
LLRMVLFVARPRTTVLGNIPNSKIYRSVDQYPAASTVPGVLILEIDAPIYFANAGYLRER
ISRWIDEEEDKLKAAGESSLQYVILDMGAVGNIDTSGISMLEEVKKSMERSGLKLVLANP
GGEVMKKMNKSKFIEVLGQEWIYLTVGEAVGACNFMLHTCKPKAMTDDSSMV
Download sequence
Identical sequences D7TE10
29760.GSVIVG00023771001 GSVIVT01001198001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]