SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00023959001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00023959001
Domain Number - Region: 53-84
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0863
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00023959001
Sequence length 87
Comment (Vitis vinifera)
Sequence
MCPLRLILIFLSATLAGFFVLRNLKSQPQVVADAPADGDRDDNDPHDSTPKSSKVLSAIG
SGFWTCVDMASGRYLWRHLVSSSKPSD
Download sequence
Identical sequences 29760.GSVIVG00023959001 XP_002269081.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]