SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024110001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024110001
Domain Number 1 Region: 166-502
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-34
Family WD40-repeat 0.014
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00024110001
Domain Number - Region: 101-121
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00663
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024110001
Sequence length 559
Comment (Vitis vinifera)
Sequence
MAPRTRRGSFPRVVIERDTESEKSSSSEEEEDPEPEVQEEEESEELAEVENGENVEEGLG
SKKKERVPITIALTKVCKVCKRKGHEAGFKGATYIDCPMKPCFLCKMPGHTTMTCPHKVA
TEHGVIPAPNRNTRSSLDYVFRRQLQPDIPAIKTAFIVPNQVDCAVIRYHSRRVTCLEFH
PTNNNILLSGDKKGQLGVWDYNKVHEKTVYGNIHHCILNNMRFKPTNDETIYAASSDGTI
SCTDLETGISSSLMNLNPNGWEGPSTWRMLYGMDINSEKGLVLVADNFGFLYLVDTRSNN
QTGEAILIHKKGSKVVGLHCNPLQPELLLSCGNDHFARIWDMRRLEAGSSLHNLPHGRVV
NAAYFSPQSGCKILTTSQDNRIRVWDSIFGNLNSPSREIVHSHDFNRHLTPFRAEWDPKD
PAESLVVVGRYISENYNGAALHPIDFIDISTGQLVAEVMDPNITTISPVNKLHPRDDVLA
SGSSRSLFIWRPRDKSEPVQQKNEKKIVLCASEKKTRRKFGGVDSDNDSDDDTFSSKGKN
FKSKKLGSKPTPKSLRTKR
Download sequence
Identical sequences A5BX89
29760.GSVIVG00024110001 GSVIVT01024745001 XP_002279214.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]