SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024233001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024233001
Domain Number 1 Region: 213-295
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.2e-28
Family Canonical RBD 0.00014
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00024233001
Domain Number - Region: 143-162
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0743
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024233001
Sequence length 296
Comment (Vitis vinifera)
Sequence
MAIDNKPGWGSTQSKLRWGELEEDDGEDLDFLLPPRQVIGPDDNGIKKVIEYKFNDDGNK
VKITTTTRIRKLAKARLSKRAIERRSWAKFGDAVHEDVGSRLTMVSTEEILLERPRAPGS
KAEESKVAGDSLAQLGKGGAVLMVCRTCGKKGDHWTSRCPYKDLAPPSEGFIDKPAASEG
TATASGPSKGTYVPPGMRAGAERTGTEMRRRNEENSVRVTNLSEDTREPDLHELFRTFGP
VSRVYVAVDQKTGMSRGFGFVNFVNKEDAERAINKLNGYGYDNLILRVEWATPRSN
Download sequence
Identical sequences F6GUX9
29760.GSVIVG00024233001 XP_002282278.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]