SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00026034001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00026034001
Domain Number 1 Region: 40-374,406-418
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-74
Family L-arabinose binding protein-like 0.0005
Further Details:      
 
Domain Number 2 Region: 401-550,653-769
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-51
Family Phosphate binding protein-like 0.0031
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00026034001
Domain Number - Region: 544-632
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0471
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00026034001
Sequence length 870
Comment (Vitis vinifera)
Sequence
MEVNLTAGSGRVFMAGVLLLIFCIWVPILGRAQNASVSSSAANVVNIGAVFTLNSFIGRA
AQPAILAAIDDVNSDSSILEGRKLNVIFQDTNCSGFLGTVEALQLMEKDVVAIIGPQSSG
IAHVMSHVVNEFHIPLLSFGATDPTLSALQFPYFLRTTQSDYYQMYAIADLVDFFEWREV
IAIFVDDDYGRNGISVLGDALAKKRAKISYKAAFTPGATKNEISDLLAGVNLMESRVFVV
HVNPDSGLYIFSVAKVLGMLNNGYVWIATDWLPSVLDSSETVDPDQMNQLQGVVEQLHML
LIDPKLHDTNGSKLQLSTLHTFDGGQKLLQTLITTNFTGLSGQIQFDLEKNLIHPAYDVL
NIGGTGFRRIGYWSNYSGLSVITPEILYTRPPNTSSSNHHLYSVIWPGEITAKPRGWVFP
NNGKPLRIGVPDRVSFKDFVARDKGPLGVRGYCIDIFEAAVNLLPYAVPHTYMLYGNGLR
NPSYDDLVSQVVGNKFDAAVGDITIVTNRTRIVDFTQPFMESGLVIVATVKETKSSPWAF
LKPFTVQMWCVTGAFFIFVGAVVWILEHRINQEFRGPPSQQLITIFWFSFSTMFFSHREN
TVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDKIGVQDGS
FAWNYLIEELNIPVSRLVHLKDQEEYADALRLGPKEGGVAAIVDELPYIQVFLAKLNCAF
RIVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGELQRIHDKWLSNKECSSQLSQVD
ENRLSLSSFWGLFLISGIACFVALTVFFFRTFCQYRRYGPEEKEEDDNEIDSPRRPPRPG
CLVFIDKKEEEIKEALKRKDSKQRASNSTP
Download sequence
Identical sequences 29760.GSVIVG00026034001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]