SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00026675001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00026675001
Domain Number 1 Region: 625-648
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00026675001
Domain Number - Region: 839-917
Classification Level Classification E-value
Superfamily Acid proteases 0.000445
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00026675001
Sequence length 1058
Comment (Vitis vinifera)
Sequence
MSRRSSDSQDIVVNSEEINYPKIQNDLDDWKLPKVSNQEIYKKGTFKSVERHKKDGYNFI
HFGMIQVAAKPLTRLGLNTAIVMCLRDNRHLEYRDSIIRAVQAGLNDGPVYFQCYPNFTI
RLKDADILDSVVLHIKTHGFKIKPGNSPVSIITRFAYKSMNTSVGSGALCTSPKGETTYF
HSDMLDKSDFIIPKKILWKDVDFPENWHFANAVPAIAQRSESIEQIVQYPDGEGELVFSK
SFRHSNSPRVSVYEPSRASSSSIPVRTTREEEGSSSGNPKNVKLTGMINTISLSDEDFEI
NKDLLRKDFYSEVNKQRNDWFFSTIPKVIRTIYQEEFYAYLRQEKKNIKFWIWFELFKQE
EYPDYPCQRVDNTKSTDKTKPFEFSKEFEENPQINQAFIDRINQKIKDNLVAPLTVQPDK
RINMVKGDISSEEEADELIKMFEEPHNQIINNLETFKTRNYYPRPTFPDMQFEERNQYTQ
ASYTSGTIYEWNIDGMTEYNILTKLQEMTMVSTAYKLNNRLPDHAVAQTIVAGFTGQLKG
WWDNYLTFDDRNSILKAYRINESNEVVKDEDGQDIEDAVATLIYSISKHFIGDPAKIKDK
TADLLTNLKCPKLHDFRWYKEVFLTKPIICFKCGKVGHYKKDCRVKQKINNLSVSDDLKN
MLCKVMLNSDSESRTDSDNEDDINQLDSSAECIKGNCNCRPKTINVISQDQEFILDTLRK
VEDEKTKQNLYEVFKKSIVKVEAKKTVNPYNLNDILNRFDHQSPKEVNIKELHEEVKQHK
KEIKELRQFISLGLSDLQDQINRIGNQENLMDIPESSHVNDNETDTFLNIVNKFVFDIIA
LIDSGAAENCLQEGLVPIPLCEETSQSLFGANGKRLAIKYKLTDVHIRNHDICIKQTFIL
VKDLNEKALLGIPFLSSIYPLWVDNQGIRTKLFDKEILFEFANPTVSITPFNQEINLVGL
DVPSKLIGNQFMHNDILSISLCISKFQIGILNQEFLLKIIFLYITFKYDLINWYIILKSK
FQSYFIKGDYFNPNQLSREFCRVHEIMAPKKNTQASSS
Download sequence
Identical sequences 29760.GSVIVG00026675001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]