SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00029002001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00029002001
Domain Number 1 Region: 230-278
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000514
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00029002001
Domain Number - Region: 331-350
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00248
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 
Domain Number - Region: 58-106
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00314
Family DnaJ/Hsp40 cysteine-rich domain 0.003
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0146
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00029002001
Sequence length 351
Comment (Vitis vinifera)
Sequence
MTRDLIGCCFLKLFYKTLGYDPSVELFGLEVDLQPRNVTSDAPKIRSWFGPNGQYIRELP
CPSCRGRGYTPCTECGIERSRLDCSQCNGKGMQTCRKCFGDCVIWEESIDERPWEKARSV
SPLKVKEDDEVDNLDIKLDVRRKSKRVYQSPSPEVGLKISRSLKSLNAKTGLFSKRMKII
HRDPKLHAQRVAAIKKAKGTAAARKRASEALKAFFRDPENRRKRSIAMKGAKFYCKNCGR
EGHRRHYCPELANSSVDRRFRCRLCGEKGHNRRTCRRSRESGTRSTVSRHHHCRICGHSG
HNRRTCPQGTGLKLDAGGTNRGSLISGSRIYACRLCLEKGHNIRTCPSKNK
Download sequence
Identical sequences 29760.GSVIVG00029002001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]