SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00029898001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00029898001
Domain Number 1 Region: 231-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000112
Family Retrovirus zinc finger-like domains 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00029898001
Sequence length 296
Comment (Vitis vinifera)
Sequence
MVEPDDAVLVVEDEDFLSAVAAVEANALSNKRRRTYTSDAAKEGIYTAALRGSNSLAWKQ
SATAASGAPSSRGSSSVSSSGKSDGGDSSPPEKPCPCGLGTCLILTSNTQKNPGRKFYKC
PLREENGGCGFFQWCDNSSGISNDAFGAINPGLNSSFPDLKCPCGAGSCLILTAKTGNNA
GQQFYRCPANQGGSCGFFKWCNDQTVPAGLPVGASRGYNTTTNASIKSYGAQSGSSCFKC
GKEGHWAKDCQMPSPEPLADSGGRPASSGTCYKCGKPGHWARDCSSSQDTKVWQRR
Download sequence
Identical sequences D7T286
GSVIVT01018616001 29760.GSVIVG00029898001 XP_002264670.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]