SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00030503001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00030503001
Domain Number 1 Region: 503-584
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000051
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00030503001
Domain Number - Region: 311-346
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 0.0916
Family MurE/MurF N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00030503001
Sequence length 593
Comment (Vitis vinifera)
Sequence
MEVHKVVPPPHRSTFQKFKTRLKETFFPDDPLRQFKGQPPKRKWILGAQYVFPILQWGPN
YSLKLFKSDIVSGLTIASLAIPQGISYAKLANLPPIVGLYSSFVPPLVYAALGSSRDLAV
GPVSIASLILGSMLRQEVSPSKDPILFLQLAFSSTFFAGVVQASLGILRLGFIIDFLSKA
TLIGFMAGAAIIVSLQQLKALLGITHFTKQMGLVPVLGSVFHNTAEWSWQTIVMGFCFLS
LLLLARHVSMKKPNLFWVSAGAPLASVIISTLLVFAFKAQHHGISIIGKLQEGLNPPSWN
MLHFHGSYLGLVMKTGLVTGIISLTEGIAVGRTFAALKGYKVDGNKEMMAIGLMNIVGSS
TSCYVTTGAFSRSAVNHNAGAKTAASNIIMAVTVMVTLLFLMPLFQYTPNVVLGAIIVTA
VVGLIDLPAAYQIWKIDKFDFIVLLCAFLGVIFISVQQGLAIAVGISIFKVLLQVTRPRT
GMLGNIPGTDIYRNIHHYKDGMKVPGFLILSIDASINFANTTYLNERILRWVEEYEAQDA
EEEGKKHSSLQFVILDLSGEFTIDTSGVSIFSDLKKALEKKGLEANGVGEPGG
Download sequence
Identical sequences 29760.GSVIVG00030503001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]