SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00032560001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00032560001
Domain Number 1 Region: 874-961
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000000523
Family Reverse transcriptase 0.0097
Further Details:      
 
Domain Number 2 Region: 774-800
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000523
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00032560001
Sequence length 1277
Comment (Vitis vinifera)
Sequence
MSSIFRTMSRRSSDSQDTIVNSEEINYPKIQNDLDDWKLPKVSNQEIYKKGTFKFFTDYT
IKTSEMTVNLEQDDQVIRLLDNRSVEKHKKDGYNFIHFGMIQVVAKPLTRLGLNTAIVMC
LRDNRHLKYRDSIIGAVQAGLNDDPVYFQCYPNFTVRLKDADILDSVVLHIKTHGFKIKP
GNSPVSIITRFAYKSMNTSVGSGALCTSPKGETTYFHSDMLDKSDFIIPKKILWKNVDFL
ENWHFANAVPAIAQRSESIEQIVQYPDGRGELVFSKSFRHFISPRVSVYEPSRASSSSIP
VRTTREEEGSSSRNPKNVKLTGVRSYTNVARPFYSEENESTQESQQDESLVMSPTYSQMI
NTISLSDEDFEINKDLFRKDFYSEVNKQRNDWFFSTVPKVIRTIYQEEFYAYLRQEKKNI
KFWIWFELFKQEEYPDYPCKHINNTKSTDKTKSFEFSKEFQENPHINQAFVDRINQKIKD
NLVAPLTVQPDKRINMVKGDISSEEEADELIKMFEEPHNQIINNLETFKTRNYYPRPTFP
DMQFEERNQLPDHAVTQTIVDGFTGQLKGWWDNYLTFYDRNSILKAYRINESNEVVKDED
GQDIEDAVDPAKIKDKTADLLTNLKCPKLHDFRWYKEVFLTKVMLRSDCNQSFWKEKFIS
GLPKLFSERIRIKIREQYNGQIPYDKLTYGEIISIVTAEGIKLMNKKSTRMNLDNSVAKT
MPPSKQKPSRKPSKDKFYHSKRGTHDNYRMNDTKHSRHVQRKVNKDTQKKVETLLDVKPI
ICFKCGKVGHYKKDCRVKQKINNLSVSDDLKNMLCKVMLNSSDSESRTDSDNEDDINQLD
SSGDVSSQSSSDQDVCIKGNCNCRSKTINVRLPYELDFSEKNIPTKVRPIQMNKDLLSYY
EKEIQDLMNKKLIRKSKSPWSCSAFYIQKQAELERGTPRLVINYKPLNDVLRWISTMIVG
LANHGRAREAIELFQEMQKAKVEPNIITFVGLLSACAHAGLLNEGLGYFESMERDDNIEP
GVEHYGCLVNLLGLSGRLDQAFELIKKMPMKPNSAIWGLLLSSCRSHGNLKIAAIAMEHL
LLLELEPDDTGNHVLLSNLYADLGKGDGVSRMRKLMSSKYMNKTPGCSSIEVDNMVQEYA
SEMQKAKVEPNIITFVGLLSACAHAGLLNEGLGYFESMERDDNIEPGVEHYGCLVNLLGL
SGRLDQALELIKKMPMKPDSDIWGLLSSSCRSHGNLEIVAIAMEHLLELEPDDTGNSKHS
HFQIFMQTWESGMVYRG
Download sequence
Identical sequences 29760.GSVIVG00032560001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]