SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00033191001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00033191001
Domain Number - Region: 929-950
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0117
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 522-565
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0799
Family PepSY-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00033191001
Sequence length 1090
Comment (Vitis vinifera)
Sequence
MVKVRMNTADVAAEIKCLRRLIGMRCANVYDLSPKTYMFKLMNSSGVTESGESEKVLLLM
ESGVRLHTTAYVRDKSMTPSGFTLKLRKHIRTRRLEDVRQLGYDRVVLFQFGLGANAHYV
ILELYAQGNILLTDSEFMVMTLLRSHRDDDKGVAIMSRHRYPVEICRVFERTATTKLQAA
LTSPKESESNEAKQGNNKGVKSSEPSKNTNDGARAKQATLKTVLGEALGYGPALSEHIIL
DAGLIPNTKVTKDSKFDIDTIQRLAQSVTKFENWLEDVISGDQVPEGYILMQNKIFGKDC
PPSQPDRGSQIYDEFCPILLNQFKSREFVKFETFDAALDEFYSKIESQRSEQQQKAKEGS
AMQKLTKIRVDQENRVHTLKKEVDHCIKMAELIEYNLEDVDAAILAVRVALANGMNWEDL
ARMVKEEKKSGNPVAGLIDKLYLERNCMTLLLSNNLDEMDDDEKTLPVDKVEVDLALSAH
ANARRWYEQKKRQENKQEKTVIAHEKAFKAAEKKTRLQLSQEKTVATISHMRKVHWFEKF
NWFISSENYLVISGRDAQQNEMIVKRYMSKGDLYIHADLHGASSTVIKNHKPEHPVPPLT
LNQAGCFTVCHSQAWDSKIVTSAWWVYPHQVSKTAPTGEYLTVGSFMIRGKKNFLPPHPL
IMGFGLLFRLDESSLGSHLNERRVRGEEEGAQDFEENESLKGNSDSESEKEETDEKRTAE
SKSIMDPSTHQPILEGFSEISSAHNELTTSNVGSINLPEVPLEERNMLNGNDSEHIADIS
GGHVSSVNPQLEDLIDRALELGSNTASDRKATVREKPYISKAERRKLKKGQKTSTSDAGG
DHGQEEIEENNVSTSQPDKDVKNSQPAGGKISRGQKGKLKKMKEKYADQDEEERSIRMAL
LASAGRAHKIDKEKENENADTGKGMKPVNGPEEAPKICYKCKKVGHLSRDYLDNSATEMD
RVAMEEDDIHEIGEEEKGKLNDVDYLTGNPLPNDILLYAVPVCGPYSALQTYKYRVKIIP
GTAKKGKAAKTAMNLFSHMPEATSREKELMKACTDPELVAAIIGNVKITAAGLTQLKQKQ
KKGKKSSKAS
Download sequence
Identical sequences 29760.GSVIVG00033191001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]