SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00033958001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00033958001
Domain Number 1 Region: 278-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000712
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 
Domain Number 2 Region: 236-278
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000884
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 3 Region: 39-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000053
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00033958001
Domain Number - Region: 321-341
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00046
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Domain Number - Region: 114-165
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.00102
Family Hermes dimerisation domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00033958001
Sequence length 349
Comment (Vitis vinifera)
Sequence
MTSEEGENFSMPSEGSTPITGSTSTTDGTLVSKRRKLTSVVWNDFDKIIEDGQDYAICKH
CKGKLKVDTKNGTKHLHVHIDRCMKRRNVDWQQLLAVERKGHGKVQIGGFTFDKEISREK
LARAIILHEYPLSIIDHVGFREFATSLQPLFKMVSRNTIKGDIMKIYEFSIASFRTRNVL
FSMVYYLFVGIVVSRKDEVGASNSFCINPVDLNSFFEEDGKIYGYQGHTLPKASSSSPQD
YLCNKCKRPGHFARDCPNVTVCNNCGLPGHIAAECNSTTICWNCKESGHLASQCPNDLVC
HMCGKMGHLARDCSCPSLPTHDARLCNNCYKPGHIATDCTNEKACNIFR
Download sequence
Identical sequences 29760.GSVIVG00033958001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]